DPCstruct | MC50053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 246 ± 34 aa |
| Standard deviation of domain lengths | 34.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8PFB7 | 326-593 | VHKGSTKERHGYCTLGEAFNRLDFSSAILDSRRFNYVVRLLELISKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRDLLQT… |
| A0A6J0TV48 | 59-302 | FSNAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVQKVLEDQQNIRLIRELLQTLYMSLCTLVQGVGKSVLVGNINM… |
| A0A4U5UL66 | 223-486 | None |
| A0A6A7G2N2 | 282-574 | None |
| A0A4U1FGW2 | 243-509 | None |
| A0A2H6MWD8 | 9-207 | None |
| A0A1D2NC23 | 14-253 | None |
| A0A7R8ZZW9 | 62-282 | None |
| A0A5B8MM73 | 25-251 | None |
| A0A455AJR0 | 33-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.