DPCstruct | MC50052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 191 ± 34 aa |
| Standard deviation of domain lengths | 33.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.30 |
| Pfam Score | 98.24 |
| Assigned Pfam label(s) | CL0552- PF00118- CL0167- PF00995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0TTV1 | 7-213 | KAVVGEKILNDVIRSMKKEGEWKVLVVDHSSTRILSSCFKMSDLLAEGITIIEDINKRREPLPSLEAIYLISPIETSVQALINDFKG… |
| A0A1Y2CVX7 | 18-199 | SVVPNQWKLVVVDAKSLQILNSVCEIYDILDENVTLVESIERKRQPYTNLEAIYFISPTAESIDRLIADFQQRPLYAAANVFFTAAL… |
| B0E861 | 8-155 | None |
| A0A5P1FLU7 | 16-154 | None |
| A0A7R9NZB0 | 334-530 | None |
| A0A7M3RQ67 | 1-202 | None |
| A0A3Q3F9R5 | 61-250 | None |
| M1V708 | 64-252 | None |
| A0A2P4ZBU4 | 240-438 | None |
| A0A421JHH5 | 6-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.