DPCstruct | MC50050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 149 ± 30 aa |
| Standard deviation of domain lengths | 29.95 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B4CNR5 | 1-145 | MSIPKRHHYLPQFYLKAWSRADDTVVSFRRPHRLVLAEAKTPYATGFEDRLYSIPTEPDPESQEQVELRWMSPIDNEAAKVRDQLIE… |
| D2B616 | 58-251 | GSPPRKHHLIPASYLHRWAEDSKVRVTVVDEHRSYLSSPEKAARETDFYRIEHPGVDADQVPPLLFETMLSRIEGNAKTVIDELISH… |
| A0A1R0YQX1 | 1-118 | None |
| A0A2D5UA24 | 5-129 | None |
| A0A239L959 | 2-143 | None |
| A0A2D1TZI9 | 6-173 | None |
| A0A178AHI2 | 1-141 | None |
| A0A2C4G7Q3 | 1-88 | None |
| A0A0G0G7S3 | 1-111 | None |
| A0A1C7F4B9 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.