DPCstruct | MC5005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2299 |
|---|---|
| Mean domain length (aa) | 302 ± 76 aa |
| Standard deviation of domain lengths | 75.62 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.60 |
| Pfam Score | 98.04 |
| Assigned Pfam label(s) | CL0489- CL0022- CL0289- PF02729- PF03711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3R5Z7 | 10-286 | REEALAGHHGVDPESVVLGVGSSEILLTATLAAFWNNPGNAVTAFPSYRSIPRTAEELGQAVKQVPLTGDWQIDLPAISAAVDDNTR… |
| A0A7X9H4V1 | 69-248 | YPERDSVELRDALAEYITHQTGVTVTRENLWAANGSNEVLQQLLQAFGGPGRTALGFQPSYSMHPILSKGTQTEFIAVPRGADFRID… |
| A0A7R9KKU0 | 7-300 | None |
| A0A7J0G471 | 19-344 | None |
| A0A5C6Z938 | 40-294 | None |
| A0A084R763 | 93-507 | None |
| H0EH69 | 153-387 | None |
| H0ELD3 | 10-176 | None |
| A0A1L9T326 | 100-555 | None |
| R9P0I2 | 192-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.