DPCstruct | MC50047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0LLC1 | 284-389 | QPYLTRRDIFKNVDLLLEIIVEHDKRCSFRKLNDAFDRLIETKGETVGEVLEILSYEEHFRNFIGEKLKVPSGQVELVFGRSLTDLV… |
| A0A3N5IP51 | 1-119 | MERVRPINRLDLFAPLDPVLPVIKAHEEKCDLLSLERSLQRAGEQRKDGQDRVMEGLGFDRHTREFLEEKYGFRPEHLLFLLGRPLT… |
| A0A0S8CPM1 | 1-114 | None |
| A0A7C4ARG9 | 258-372 | None |
| X0X6X4 | 2-92 | None |
| A0A522V3D8 | 142-249 | None |
| A0A1I4TSL0 | 196-301 | None |
| A0A7C1B1S2 | 93-197 | None |
| A0A7V8DKB5 | 143-251 | None |
| A0A1F9MK52 | 115-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.