DPCstruct | MC50045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 158 ± 40 aa |
| Standard deviation of domain lengths | 40.21 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04216 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5IDB2 | 26-169 | SLQFTLGQIVKPLVEKRAEALRPLIAGFGWHKGYCPVCGSSPEISFIAEGQRWLRCALCSHHWRFVRLSCPFCENGEQEKLSIYYID… |
| A0A3S4VP31 | 2-103 | ASVVHFGDTQGLRYLHCALCESEWNMTRSQCSVCDQSGKLDYWSIDSVDAAVKAESCGDCESYLKVLYQEKDPHVEPVADDLGTLIL… |
| A0A3S4FY38 | 9-105 | None |
| A0A356Z8R7 | 65-244 | None |
| A0A8B0TDH0 | 343-523 | None |
| A0A523DZS7 | 14-134 | None |
| A0A5C8PT01 | 102-302 | None |
| N6UBL0 | 90-279 | None |
| A0A5E5R1F0 | 27-219 | None |
| A0A7V3ELA6 | 72-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.