DPCstruct | MC5004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 123 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9RPZ9 | 626-743 | DLNINAFALNWYDAKGKPNEDVEEANYLMERVVKRLSIDSPNDKPSKIPFYLTSTEFEHELYGKCAATFKRRLELDDSTQQPVMVLR… |
| A0A7W1UL93 | 15-140 | FRVVPLPAPDINIVCFGVGHPSLRTLEDTNRFASRVYRAMSVGEDRPARQLEYFVTKTELRAGEYGHAADPVVEALGFTHDDYLRAG… |
| A0A3C0I1K6 | 347-478 | None |
| A0A0F0IE73 | 203-323 | None |
| A0A7M5UXP6 | 506-627 | None |
| A0A7M5X214 | 68-190 | None |
| A0A397V2X7 | 288-405 | None |
| A0A846ETT3 | 270-405 | None |
| A0A5N6E1B4 | 49-169 | None |
| A0A3M6T845 | 195-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.