DPCstruct | MC50032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 218 |
|---|---|
| Mean domain length (aa) | 326 ± 73 aa |
| Standard deviation of domain lengths | 72.51 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 80.33 |
| Assigned Pfam label(s) | PF00330- CL0020- PF04412- CL0159- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5F2I4 | 45-327 | MRDAMTNLGNDPNKINPSIPVDFVVDHSVQVDVSRSEDALQVNMELEFERNKESFAFLKWGSHAFDNMLIVPPGSGIVHQVNLEYLE… |
| A0A6D0EK43 | 2-210 | TTGPMTRDELKDLACLGFSSDLVMQSFCHTAAYPKPVDVTTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRF… |
| A0A534BGN1 | 78-460 | None |
| A0A7W8CZY9 | 3-291 | None |
| A0A7R9KP80 | 275-698 | None |
| A0A4V5NDJ8 | 119-527 | None |
| A0A7C7PDK4 | 7-347 | None |
| A0A377D2L5 | 8-325 | None |
| A0A1M7PF56 | 9-372 | None |
| A0A6V7Q1N4 | 239-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.