DPCstruct | MC50031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 30.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7MYZ8 | 23-186 | RAFARDLQATDDWRQVWSPEGFQLIINEFNNFPCMNNPMEGHGERIMRFLPDWDPQLLFVMANRRSCLEAVNRQHPGLIQQRFRFRG… |
| A0A2P5ESS7 | 22-180 | DLESALEKYRSSLRDFCDVMDTSEERVDQNSALLFLYMDCPIMATCLARNCLVFNNRNGRVRVTSLPPYLKDVTFYEICKKLRALGG… |
| A0A2P5AVM3 | 1-133 | None |
| A0A2P5AU11 | 1-170 | None |
| B0DB70 | 183-437 | None |
| A0A439R851 | 81-263 | None |
| A0A6P0C5D9 | 12-153 | None |
| P15397 | 62-225 | None |
| A0A1S7NGS7 | 5-143 | None |
| A0A2W4BJS1 | 21-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.