DPCstruct | MC50025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3MEG7 | 1-85 | EKALGQKVIVPKYNKVMGAFGVALLVKEHPPQKTKFRGFEISDMDIKCDSFQCKGCPNQCEVIEAKMNDKIIARWGDRCGRWSNL |
| A0A6V8P3W8 | 51-138 | ERELEMEIIVPRYFSVMGAIGAAILAKEKVGETRETRFRGFDMVNAQYRTKSFECIDCPNMCEIIEVMMDETLISRWGDRCGKWAYVE |
| A0A847ZKT9 | 368-471 | None |
| A0A7R9NFZ1 | 43-146 | None |
| A0A7C6MM67 | 1-66 | None |
| A0A4Q2WMW8 | 1-82 | None |
| A0A4Q2WF27 | 131-217 | None |
| A0A7C3A685 | 164-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.