DPCstruct | MC50021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 69 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345Y1X0 | 3-71 | WPPVAQTGDGNVWVTGACWLYCRREGVRVLWVGSVRTPGTTGDVYACGPCIAELDRIVRVTSQERAGTT |
| A0A2A2D3R7 | 12-78 | IDQDEITALYAWAPGSCFRCAAVGADTTKLDVIDTPIGDRYEIRACRRCVIDLEGERRWHAERCETD |
| A0A1H9CPK7 | 5-65 | None |
| A0A1C5CTB0 | 2-66 | None |
| A0A1W7D6W1 | 1-58 | None |
| A0A561UYR1 | 48-134 | None |
| A0A6I6N4T2 | 2-60 | None |
| A0A7L7MEJ9 | 32-89 | None |
| A0A7X5XCM0 | 1-62 | None |
| A0A0N6ZIN2 | 14-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.