DPCstruct | MC5002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4M4W5 | 285-360 | APSMGWYSADEKVTVNGQTYVKYGLPRTLLPGSVVPAGEFGGVSVYGAPGVAAPGSIYLPVARDCVFHEYRREREV |
| A0A7W1HBR3 | 134-227 | TGCPIEEPEGETCLGSQDWYTGDATISFDGRNWVKFGSTQTATMDQLTQVGEYQGVPIFVGQNAQRPHREVWLPLCSPADTYQPYRP… |
| A0A2J0LDZ3 | 50-140 | None |
| A0A3B8UZ01 | 44-146 | None |
| A0A6C1NMM2 | 254-343 | None |
| A0A2M7TQW5 | 72-160 | None |
| A0A4Q2Z7E7 | 15-96 | None |
| A0A7W0YPQ2 | 312-396 | None |
| A0A356J006 | 18-110 | None |
| A0A843T1C5 | 74-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.