DPCstruct | MC50015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 195 ± 27 aa |
| Standard deviation of domain lengths | 27.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3N0M8 | 2-221 | TVKAWLEGDRSDLQALTRLLVEVDARVVHDANEDAYYLTAPEIDSPSEPRRFDRAAEPLLRRINGMARVQNADYQPVKLSGKYTDHN… |
| A0A349XVW6 | 8-255 | KWSFSLDVNYSWIDSFANQFPGGDIEIVQDLWDGGPTQYRWSSPHLNGLTDPNRIASRAAALKAIFDGAMLVHRLGDYQRSRLLRPV… |
| A0A4R7K3Z0 | 1-145 | None |
| A0A7V0NPP5 | 73-258 | None |
| A0A0G8EYM2 | 5-222 | None |
| A0A5C8S5J8 | 6-227 | None |
| A0A849QUY6 | 6-185 | None |
| A0A2T1EC85 | 2-197 | None |
| A0A829Q9X7 | 2-175 | None |
| A0A504AQT1 | 2-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.