DPCstruct | MC50012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 167 ± 17 aa |
| Standard deviation of domain lengths | 17.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6FVV2 | 9-181 | YNVLMNGIIKDINDAWDRKSYRATLILVYIGIDAMAHLTMPAEKEKVTRTDFVAWTERYLRFRNAERQPTLAVPGLELYAARCAMVH… |
| K2A0X3 | 90-248 | KNWFFHYGHKLKTDYNAGFIILQIAISQIEGVEQYQCGNSSQSNSKITFRAGFKKIFSSINVADSLIDEFYIHCRCGLLHDGMTRPP… |
| A0A1F8EBT4 | 8-177 | None |
| A0A2E0IGW9 | 6-143 | None |
| R6RWL6 | 10-178 | None |
| A0A7C3CU69 | 8-180 | None |
| A0A1Q7JZB2 | 19-205 | None |
| B1F977 | 155-315 | None |
| A0A523X168 | 12-187 | None |
| A0A416MF71 | 5-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.