DPCstruct | MC50011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6EMI9 | 2-162 | YDNTGGILVFALKAPPRFKTTENVVVRNNRITDNNTPPFVNASGLVLTIPPGTGVMVLASQNVEVYNNTITKHKTTGVLLISAYAAN… |
| A0A7Y3G4F0 | 78-229 | IVENNYVHNNTGGILAFITPGLPIKTTYDVIIRNNFVVDNNHKNFGAPGSTVAGIPAGTGLLIMAADEVVIEGNIIAGHKTAGILIT… |
| I2JNN1 | 459-581 | None |
| A0A2E6UMA9 | 316-452 | None |
| A0A534NNP4 | 154-321 | None |
| A0A399YVE4 | 543-707 | None |
| A0A5C8NKX0 | 377-556 | None |
| A0A6L5FYQ0 | 302-517 | None |
| A0A7U1E5G0 | 52-194 | None |
| A0A538ATK0 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.