DPCstruct | MC50003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04770 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4NUR4 | 8-84 | VRRLEGPPSRSVRSVKYGECQKNHAANVGGYAVDGCREFMASGDEGTSSALICAACNCHRNFHKKEVETETVSECSS |
| A0A834LN50 | 18-91 | IVTYHECHHNHPRRRGRYFMDRCTEFRKAGEDMTPKALICTACGCHRNYHRREELSVAIDPATHHLIHQMAIAP |
| M1DLB4 | 7-93 | None |
| A0A0K9RNS5 | 34-126 | None |
| A0A7J7GPE5 | 18-120 | None |
| A0A3L6PMQ2 | 23-124 | None |
| A0A6J1H040 | 1-62 | None |
| A0A0E0QRE2 | 26-103 | None |
| A0A834TV75 | 9-96 | None |
| A0A2G2WQY2 | 121-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.