DPCstruct | MC5000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673B7G6 | 1-115 | MASAYLTHQQKVLRLYKKSLRHLESWCVFRDKYRFYACMLRARFDENKNEKDLVKATMLLKAGEEEFWSNQHPQPYIFPDSPGGTSY… |
| C0NZ92 | 6-106 | TALSLYRRSLKLALDWAVHRHLWRGQAVYIRSLFDANRHVREPRQQKVLFRETEKLLIEWKHPDPYRAPTAPGGSKYERNSELPILP… |
| A0A1E5VLF0 | 12-119 | None |
| A0A452VBA1 | 10-135 | None |
| A0A482VIW2 | 76-184 | None |
| A0A066VQM5 | 87-187 | None |
| A0A1B0BZY6 | 30-113 | None |
| G3J3S4 | 69-170 | None |
| A0A4Z0YKG6 | 100-209 | None |
| A0A061RMM1 | 98-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.