DPCstruct | MC500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6VDF0 | 1-122 | MNFRRGTGAGAPAAVANAPVAVATGSPSAATITEKLDKFIEVSTKARKDREKVSEVQQNLANNKLEAAKLAHKAAQEQVKCKMLDTY… |
| A0A453LKN1 | 1-137 | MTEKVGNKTSVETNLTPNMINLEAEERPSAGRDKAKVERAGKGKSGGLSQELGERLDKFIEVNNQSMEDRQKVIDSQVILSNQQLET… |
| K3XMF5 | 1-156 | None |
| A0A835KY39 | 135-256 | None |
| A0A6G1EF43 | 10-140 | None |
| A0A0E0B198 | 252-377 | None |
| A0A194YI95 | 170-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.