DPCstruct | MC50
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 140 ± 25 aa |
| Standard deviation of domain lengths | 25.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7D3T4 | 12-161 | HVYSEIGELESVLVHEPGREIDYITPARLDELLFSAILESHDARKEHKQFVAELKANDINVVELTDLVAETYDLASQEAKDKLIEEF… |
| T0U2C9 | 5-138 | IQIFSEIEPLKRVMLHRPGAELENLMPDYLEDLLFDDIPFLAQAQQEHDFFAKVLVENGCEVVYLEDLAAETLQLSGCKEAFLDDYL… |
| A0A2V7J7W0 | 6-127 | None |
| A0A812TVH4 | 375-484 | None |
| A0A6P4K9L5 | 284-410 | None |
| X8DNB1 | 11-145 | None |
| A0A090P4Q5 | 1-144 | None |
| A0A2R6J7U8 | 3-170 | None |
| R5N9K3 | 5-164 | None |
| A0A7I8CUW8 | 15-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.