DPCstruct | MC5
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 159 ± 39 aa |
| Standard deviation of domain lengths | 38.84 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5TDD5 | 16-156 | FSSLISGEDCVWNKDNDYPGYPPLLINKDTWISLKAVKENDERVVRIAENTVVVVACSGTLIQSLQEEVVEGFCEGGQNLNIGGSSY… |
| A0A182N2I3 | 11-149 | LVALAHGQCSVDFHSKLKTPEPVFLRKNNNQIVLWVPNGPLLQWHAGEATLIACPGNKIKLGDVKTETVTAYIQCVSGTLFKIGEQP… |
| A0A194PXV8 | 109-262 | None |
| A0A2P8Z4T0 | 3-135 | None |
| A0A7R9B6E7 | 201-350 | None |
| A0A0N1II16 | 17-150 | None |
| A0A6P7FV24 | 386-527 | None |
| A0A1B0BCX6 | 1-232 | None |
| A0A1B0BCY7 | 3-214 | None |
| A0A182W205 | 4-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.