DPCstruct | MC49996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 63.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5XN05 | 8-120 | SKLFPPPLSSLNENGQPCFYLKPVRKDGRLELTEVKIPRPDILHAVRENGRLRLHLLRSHNDQDISSKINEEKEEKVEESWKHRVTE… |
| A0A2P2PLR5 | 35-140 | RAIPPPISCIGKSGRPGVYFQSYRQDGRFVLREVRIPTQELLHACREDGRLKLQFIQPNDEVHDEAEYEEYDNESFTEDGEQEETVD… |
| A0A6A3D1W7 | 42-162 | None |
| A0A7J7DKU6 | 28-138 | None |
| A0A6P3ZD48 | 238-352 | None |
| A0A6P5H2T5 | 55-166 | None |
| A0A1S4DP69 | 1-129 | None |
| A0A7I8L7F6 | 121-249 | None |
| A0A1S4AI03 | 89-229 | None |
| A0A2P6QE28 | 196-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.