DPCstruct | MC4999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 358 ± 49 aa |
| Standard deviation of domain lengths | 48.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9VUJ5 | 20-364 | AAAEIPVAISLYDLLHNSLILRHVAPYLPIASLLHLAAASRYFRHLILQTPGVFRHLDLSRVQSLQPEYRRIRPDDSITEDDFYSGP… |
| C0NYT1 | 238-639 | LSHTPASISLLDLLSNSLILDHIAPYLSISSLLSLASTCTAFHSIIMDTPYVFRHMDLTTCRAAQPPPSMGPIDAGGEVWRSERMDE… |
| E5A8Q2 | 5-279 | None |
| A0A0F4YWP9 | 79-450 | None |
| L7J298 | 1-406 | None |
| A0A168DX04 | 75-465 | None |
| R1ER50 | 384-662 | None |
| Q2GTF1 | 22-415 | None |
| A0A232M0U7 | 99-443 | None |
| A0A5J5EWP3 | 107-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.