DPCstruct | MC49987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7ECP7 | 22-116 | IKSSNEIDHLSCLKCKQHTLQLREKVVKCLNTDCNWILFKEVCGVKLLVEDIADLLEQGETKLQKGLISKAGKKYDAYLILKEDYTT… |
| J9FKG8 | 43-131 | QSVIGKCPHCGGDIRVGTRAFNCSNYSNQQAPCNFSIWRNIGGHQLSLAEAKEICEKEITSNELEMYRDDGTIYRKRLGLSPDKLQI… |
| A0A0J6F7G4 | 36-149 | None |
| A0A7J5JAJ9 | 2-88 | None |
| A0A848A4E9 | 320-456 | None |
| A0A7Y0Q4A3 | 121-229 | None |
| A0A1G5DHH7 | 40-156 | None |
| A0A1G5D8S6 | 3-102 | None |
| A0A7Y4VKW8 | 6-107 | None |
| L8GGF9 | 954-1072 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.