DPCstruct | MC49986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 239 ± 32 aa |
| Standard deviation of domain lengths | 31.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F0ZVI8 | 12-230 | YLVGFDYVKTDDRIKWEYIGFRYYDIDNQFKETTVNVLDEIRKTAPKAFIYDYQINVNSGVSVVDLIYFDSRSAMERSIGNGKNIYY… |
| A0A4V6Z4D3 | 89-320 | VNSNYLVRHRERVRGVVPSKKMKSDEYAYLDIFDLTNKKATKKEVDVWKLMVNYLKNDNIELHRTLPTLRRIGSNDYVVLSITEQKK… |
| A0A496NP76 | 35-329 | None |
| F3UUL7 | 61-321 | None |
| A0A2L0D3F5 | 88-323 | None |
| A0A3R9KA45 | 107-347 | None |
| T0TSX5 | 251-485 | None |
| A0A139PJQ8 | 1-199 | None |
| A0A1B1IHI2 | 19-218 | None |
| A0A139ML55 | 51-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.