DPCstruct | MC49985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 21 aa |
| Standard deviation of domain lengths | 21.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8IL97 | 5-145 | YRTRSAETWAKARDDYLAGCSAETVCRRYDLGLAGFRLRARRYGWRRCDQVTPPPGEADLALYADIDLEAQIKTAGLRFVEALEGGK… |
| A0A519HIV2 | 1-133 | MEHYRLRKYRGPETWAQVRKAYVAGESAPSVARRFDVGLANLRRRARVEGWTRSKIAERLDLKPLRGGADDPSPALMALAELEAMPE… |
| A0A0Q7EB87 | 31-189 | None |
| A0A0Q5V789 | 1-213 | None |
| A0A7L5Z940 | 1-119 | None |
| A0A7W6JHI1 | 8-155 | None |
| A0A2W6RCD5 | 41-173 | None |
| A0A7W6A799 | 1-149 | None |
| A0A160I274 | 92-224 | None |
| A0A2W4SMJ5 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.