DPCstruct | MC49977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 110 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.77 |
| Pfam Score | 80.09 |
| Assigned Pfam label(s) | CL0025- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9G8N7 | 3-82 | VVNALSSKVVVQVKRDGHVYQQEYHRGVPQYEIRVVGDTDDHGTTVTFLPDPEIFTETTVYDYNTLLTRIRELAFLNKGI |
| A0A378A8A8 | 46-108 | VNALSKRVEVNVRRDGQVYSIAFENGEKVEDLHVTGTCGKRNTGTSVHFWPDESFFDSPRFSV |
| A0A540M343 | 204-328 | None |
| A0A0Q9TT02 | 108-188 | None |
| A0A7V7T386 | 105-220 | None |
| R1BRX6 | 196-327 | None |
| W4PBL0 | 117-242 | None |
| A0A2E7C2K8 | 112-238 | None |
| A0A4S4CYT8 | 34-124 | None |
| A0A4S4DEP8 | 7-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.