DPCstruct | MC49974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 24 aa |
| Standard deviation of domain lengths | 23.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090S659 | 170-264 | EKDTYDAFQTLEYQINTLNTSNGQTPFTTLGFGLGTSWEAQLIQKSILKVRMDGLGKKKKTAIFPKLVFTIKEGLNRQKSDPNYDIK… |
| V9G393 | 2-133 | NEVKQAAESLIHNLNTMSSRAGGQIPFTSLNYGMCTSTEGRMVSDALLDATLQGLGGGETPIFPQHIFQCKQGINQAEGEANYDLFL… |
| A0A0A2W4U6 | 568-660 | None |
| A0A174BK58 | 88-226 | None |
| A0A848CE30 | 318-441 | None |
| A0A842SCI5 | 682-833 | None |
| E7GEL9 | 311-462 | None |
| T0D7I2 | 12-143 | None |
| W6N4X3 | 125-244 | None |
| A0A2I0Q6G8 | 7-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.