DPCstruct | MC49965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3F4C3 | 65-130 | PSPARVTPYRDGPYLLRGRFELTDQDGEPIPCARSTVALCRCGRSQIRPFCDGTHKLVGFRAESGA |
| A0A399YX29 | 163-219 | LTVIAEKCGPLQLNGPLELYGSDGSLQYAGNETWLCRCGGSGNKPFCDDTHLRNGFA |
| A0A3A0G5B0 | 1-76 | None |
| F3ZBU3 | 3-56 | None |
| A0A1E4BC61 | 97-175 | None |
| A0A538H6U3 | 55-112 | None |
| A0A2E0WBB4 | 89-155 | None |
| A0A7V5DDM7 | 71-130 | None |
| A0A6I7YST9 | 1-75 | None |
| A0A1Z8NSM8 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.