DPCstruct | MC49964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 374 |
|---|---|
| Mean domain length (aa) | 184 ± 38 aa |
| Standard deviation of domain lengths | 37.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 12.61 |
| Pfam Score | 64.98 |
| Assigned Pfam label(s) | PF16074- PF07963- PF15980- CL0327- PF16152 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379XMG9 | 6-148 | NTRQLSLEDEIWQRTYTIAKHLQRAGYCHGHCIGEGLHLAEQGQCVIVQWDGNNNGVWDTIPAKEADQTGFRVKDNVLETLRGATSC… |
| A0A352F4F4 | 8-190 | SSNKFERGFSLLELTIAMAISLAVLAAASTLLATSLRTRTRENTRSEALASAQRTLNIMTREIGNSGYGLNDNGIVTADSGVSSIRV… |
| A0A1G2XDQ6 | 1-275 | None |
| A0A371JGV3 | 23-214 | None |
| A0A2E1H5I0 | 1-200 | None |
| A0A1G1YYI4 | 13-162 | None |
| A0A3D3P0C9 | 36-260 | None |
| A0A367ZCU4 | 7-198 | None |
| R6ZAV4 | 1-166 | None |
| A0A182TIY4 | 94-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.