DPCstruct | MC49962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1062 |
|---|---|
| Mean domain length (aa) | 223 ± 44 aa |
| Standard deviation of domain lengths | 44.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.19 |
| Pfam Score | 54.63 |
| Assigned Pfam label(s) | PF20167- CL0125- CL0114- PF10536- PF05278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4Q2Q1 | 24-239 | ILRGQVNGVGYFPDARLMPYLELAGFGSTALTRTFDLRYDLISALVERWRPETHIFHLLCGECTVTLEDVALQFGLPIDEDAVTGVS… |
| A0A6D2KLB7 | 16-267 | EPEAQKSISYGSNDKKLFAAVKKLLSDAEWETLCDSRVGVFCKFHDLDFAWSSKLVHTMLSYQLECKKKYEIWVAVADSPIRFSLHE… |
| A0A803QHE2 | 61-346 | None |
| A0A2G3CUP3 | 16-198 | None |
| A0A2G3CHF7 | 36-252 | None |
| A0A2G3CH59 | 160-330 | None |
| A0A2G3CEW5 | 237-502 | None |
| A0A834SN76 | 139-396 | None |
| A0A2N9IRF6 | 499-780 | None |
| A0A2N9IVH6 | 248-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.