DPCstruct | MC49959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 164 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A163Q6W1 | 1-141 | MQFGWKAIATSVNQQSANAYLDDMGLTTATEPRSTMATDGSPADISWENLDGLSYYTQTLAAHATDKASHNLLGHMGSALFDQLQGA… |
| A0A7W4WE64 | 417-610 | TGVTPERFSARIAPNLVGMGLLEAIRESAILAQADPEDSDGDGISGRANRVLDPETGDTRLGRFGWKAGTASIRHQLARAFNTDMGI… |
| A0A7C2MWH4 | 190-377 | None |
| A0A3M2C3W3 | 26-160 | None |
| A0A1H9QE65 | 276-461 | None |
| A0A1B2CTL5 | 450-629 | None |
| A0A537JAC3 | 11-150 | None |
| A0A1M7R4K7 | 645-790 | None |
| A0A1I0DPI2 | 825-1008 | None |
| A0A439EYN7 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.