DPCstruct | MC49954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 287 ± 46 aa |
| Standard deviation of domain lengths | 46.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2DXB7 | 69-365 | SPNYHDSPRSVRSQRSSNSSRSSIPIKKKQKPKEDTSQLKETSEYDMSHIPTPTSLQDIISVLEVDKNRAVSARDYHQAQKIYNIIH… |
| A0A078AWS0 | 2-202 | ARNRINELRQKDQTNKWNQLLQHQENERQEVEQSHIIEYQQFNKVWDDKTIKLMQDHEKLLHDLEIQQVRQLEENRQKLEQELPTQI… |
| A2D859 | 49-420 | None |
| A8JH95 | 29-309 | None |
| A0A7J6L4T5 | 15-290 | None |
| F0WIM3 | 102-363 | None |
| F0WHT4 | 8-231 | None |
| A0A812TLF3 | 11-283 | None |
| G0QZ82 | 212-482 | None |
| A0A5J4X0G1 | 1-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.