DPCstruct | MC49953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28922 |
|---|---|
| Mean domain length (aa) | 283 ± 60 aa |
| Standard deviation of domain lengths | 60.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.36 |
| Mean intra-cluster sequence similarity (%) | 10.59 |
| Pfam Score | 82.37 |
| Assigned Pfam label(s) | PF02751- PF10395- PF19755- PF00045- PF03736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3GRG8 | 2-294 | YVHTPFPNIVYALDLNEDGAIKWKYEPKQDPNVIPVMCCDTVNRGVAYGDGKIILHQADTTVVALDAKTGAVAWSVKNGDPAIGETG… |
| A2DVG8 | 20-305 | PGMTVGCIAYSPDGSQVAFSSSPNEMVVKNVINGEDVQTLQQSVTSHPLISCFFHPIEEDFLFTIYKDGHMFLYDMQTNEVLKTSRH… |
| A0A0E0GFR5 | 80-497 | None |
| A0A0E0GGT2 | 17-316 | None |
| A0A0E0H2B9 | 21-420 | None |
| A0A453DTX6 | 159-483 | None |
| A0A446IQ14 | 246-563 | None |
| A0A7S2U5Q0 | 124-512 | None |
| A0A5D8YNT9 | 79-304 | None |
| A0A5D8YQG5 | 311-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.