DPCstruct | MC49951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 175 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2DHZ5 | 93-231 | PLMPANVKKVNNEKDYSTNNLESIADEVASTFQIDADKVRLFFRLNKWSKSSKQLFNVIQFDRLNMARTVSYAGTVVKITKDFDGFH… |
| A2DMK1 | 1-133 | MQTDLPMKILGVQSNKDESTDVTPDLKSLQEMIKIGYPLLVNESLTDGQEKLRYHVNKTQGRYYVTFETVKVSQEGKEFKAFFRKGY… |
| A2FGP9 | 2-202 | None |
| H3DX79 | 129-299 | None |
| A0A821LIW3 | 1-160 | None |
| A0A7S4Q183 | 212-436 | None |
| A0A1I8HF09 | 27-200 | None |
| A0A4U5NUW3 | 110-300 | None |
| A0A4U8UW48 | 14-201 | None |
| A2DE20 | 12-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.