DPCstruct | MC4995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 202 ± 10 aa |
| Standard deviation of domain lengths | 10.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7X7A1 | 1-189 | MGDKDDGPLQDLEKTYCPPLDPALLTAIAFDYDLTDSAQLGQLRETLDALRLSAWEQEDLPFDPSGTSGLGAGHGPEADASSELSES… |
| C0NID3 | 1-205 | MDDPVDSLKNGLENEYCPPLDPALFVAIASDYNLLDDGSVRQLRDTLDALKASADEQENATFDPSGTSGRDFVAGDHDEFASEEDGS… |
| E1ZRP2 | 110-319 | None |
| A0A4U0UUU8 | 1-213 | None |
| A0A6G1NVP7 | 7-203 | None |
| A0A1S9RFK3 | 386-578 | None |
| A0A0B7JIC5 | 5-192 | None |
| A0A1Y2WXT3 | 1-202 | None |
| A0A5M8PV89 | 1-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.