DPCstruct | MC49949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2DT35 | 143-276 | NDLETFIFITEKEGFDKNQQLQSSLYPESEEGYSLLELCCYHGAVDCFKLLRTKFNSEITEQCLWFSFLGGNQDIMSECLKYQEPDY… |
| A2DJB8 | 1-112 | MNNDFEKFNQFTERDGFDKDQRLYSELYPYSSEGYSLLELCCYHGAVDCFKLLRTKFSSEITQKCLHFSFLGGNPEIMSECLKYQKP… |
| A2DAU1 | 105-238 | None |
| A2FXG9 | 105-193 | None |
| A2FEY5 | 1-81 | None |
| A2F6W9 | 1-136 | None |
| A2F5B1 | 73-195 | None |
| A2E339 | 89-221 | None |
| A2DQN1 | 1-136 | None |
| A2F0H2 | 136-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.