DPCstruct | MC49946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 262 ± 41 aa |
| Standard deviation of domain lengths | 41.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4JYH8 | 1-193 | MNSNDQNPENETPTISQTNEENDANLKQTNSANFILIDIAKCNFLLPFKPASSIFPLEQIITEFFRKKAGRKLTFQFKLFNALSLTL… |
| A2D997 | 1-227 | MLQPGFAPVLQSTMIAPQFQQAINQSAYPIFLQDNSFIQLMSTKQFSESMPMFNLQIPVANRSFDQVCADSSLTFCPSQLGLIPSSI… |
| A2DFH0 | 22-300 | None |
| A2DF95 | 43-328 | None |
| A0A1J4JPP6 | 175-440 | None |
| A2FN22 | 1-173 | None |
| A0A1J4JA72 | 379-673 | None |
| A2EIT0 | 1-259 | None |
| A0A1J4KPH5 | 131-418 | None |
| A0A1J4KJT6 | 127-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.