DPCstruct | MC49944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 174 ± 24 aa |
| Standard deviation of domain lengths | 23.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9KCS2 | 434-587 | LIFRGPQMLFNYLPRPQTGQIPEISVQTTQPDLKIWLVDNLFQPQNIPLQNTDTSVYFKIQSYNGHYFIAFDGSSYYSPSFIEEVPN… |
| A0A136NCM7 | 436-588 | RKLIFNGHIVFADWNTVGIGNIANYQIQQANANTQVWDITNPLEPIQMQSNMNGGLLSFKQDASTLHRFIAFDGSITNTPQYLEKAI… |
| A0A836SEC7 | 486-662 | None |
| A0A090Q888 | 144-346 | None |
| A0A2P1PRJ1 | 504-707 | None |
| A0A5C0VHT6 | 296-435 | None |
| A0A2E9G0N9 | 319-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.