DPCstruct | MC49941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 420 ± 65 aa |
| Standard deviation of domain lengths | 64.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6S9J3 | 3-429 | ENFNKFKKKIMIEHLIKSIIYSVSLGLGITSVLFVIFKRIPLILNFFVYLIIGVVISLIAFYLLYNAYKPKDEEIAKRLDKQFSLHE… |
| A0A1W9U9S9 | 1-376 | MTKLGVYLRRWGLRLRLVESLTWGPWGGTVGLGLGLMLALAARLWPLLMARWLAALTGSFALAGVMMGLTAAWLWPRSSLRLARIFD… |
| A0A6B1E5Y3 | 4-419 | None |
| A0A838RGQ8 | 13-278 | None |
| A0A0A8JHX2 | 4-478 | None |
| A0A511R2P9 | 1-475 | None |
| A0A2E0XG01 | 1-422 | None |
| A0A517ZLJ6 | 1-404 | None |
| A0A3M8FVZ7 | 2-469 | None |
| A0A518CYV0 | 3-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.