DPCstruct | MC4994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | PF00696- CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EM48 | 15-118 | LVNVERFPLVLYKRILRLHYGLPKEMRIIGDQYIKNEFRKHKNVSPEQAVVFLKEWREYSTVLSKQLSSRGIAKGILGVNLNSTLLD… |
| C0NCP9 | 2-112 | ANPLPITPSSRQQSALLPPLQLYRRLLRVHRKKLPKDMRLLGDEYVKNEFRAHRNVDNPIHIVGFLTEWQLYAQKLEGDTWQGEKLD… |
| A8J8W4 | 10-108 | None |
| G0UAV3 | 9-146 | None |
| A0A4S2MZU6 | 7-132 | None |
| A0A066WEJ2 | 1-150 | None |
| A0A507FSM8 | 1-126 | None |
| A0A0F4YVM0 | 14-124 | None |
| A0A5E4B7W9 | 5-98 | None |
| A0A4P9W0L3 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.