DPCstruct | MC49929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9ART4 | 1-59 | MACLQKLRQDVAMLESLFPKEHERFQVLSASVDEITVQFINPQNKPIVVTANVLVRLCI |
| A0A6P8WS98 | 1-59 | MACLNTLKQEIKTLEKIFPKNHERFQILNSSVDELLCRFIDKNGKRYDIHANITETYPS |
| A0A3Q0KDU0 | 1-70 | None |
| A0A6I8R5V5 | 1-74 | None |
| A0A310S6R1 | 1-59 | None |
| A0A1X7U203 | 4-73 | None |
| A0A2A2LYP0 | 156-224 | None |
| A0A3Q0JJP6 | 1-59 | None |
| Q4S863 | 16-83 | None |
| A0A0B6ZX54 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.