DPCstruct | MC49928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2UG65 | 44-126 | QCLSYCFFEELNIVDGNGFPDRRKLSYMLTKDIRERELRNFYMDTVQQCFRYVDNYRHNKCAQSRELIKCMTEYAKAQCDDWE |
| A0A1B0B986 | 5-99 | IDCLLHCVYAKNNAIDKMGWPTLDGLVDFYSEGVNEHGFFMATLRSVNLCLRAVTNKYHVDRHKLPEKGESCDLAFDVFDCISDQIT… |
| A0A3Q0ITI2 | 16-121 | None |
| A0A146LZ72 | 128-232 | None |
| A0A1I9HZR6 | 1-83 | None |
| A0A7E4S672 | 257-367 | None |
| A0A0N1PHV4 | 8-109 | None |
| A0A1S5VFH5 | 158-244 | None |
| A0A4C1UMG9 | 19-120 | None |
| A0A1B0AEU6 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.