DPCstruct | MC49925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 121 ± 23 aa |
| Standard deviation of domain lengths | 23.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0APZ8 | 15-141 | DDQIILADVEGYESLTTRMLADNCNVLCMVGGQRGRLLNADPSNVSFKVTKRALLRLGTLEAGNYYAEMKVVVETLDKWNASKVDIE… |
| A0A7V3LEX0 | 152-266 | LKEGAAWAVKKGYGQKEDLERMEDQGTFLNAQPETVSEKAKKRGEDELGTLGSGNHFLELQWVEKIYQSFWAKQFGLFENQICIMIH… |
| A0A7J3WNL0 | 33-160 | None |
| A0A6P5W8G8 | 1-72 | None |
| A2DG81 | 169-276 | None |
| A0A158QZI0 | 676-795 | None |
| A0A1J5AER7 | 264-429 | None |
| A0A109CFA4 | 16-148 | None |
| U6LZ48 | 7-82 | None |
| A0A2H9TNN6 | 150-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.