DPCstruct | MC49914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 294 |
|---|---|
| Mean domain length (aa) | 158 ± 35 aa |
| Standard deviation of domain lengths | 34.54 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 87.72 |
| Assigned Pfam label(s) | CL0175- PF12251- PF07929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4IKW2 | 2-175 | IDQFKLTFRGTHHPPVWIRIEVDQNMTFRGLHELIQAAFDWGDIMLHDFEVPNPQNTDKQVGGLDLNHLVEFAVKYMLPTKHIGPAD… |
| A0A7I9XQD0 | 39-212 | RPRRKQPVTLRVRADLAETKPPVWRRLELASDLMLDDVHLIIQTAFGWTDSHLHQFGSGPSYRSPGTEYYLCPFMVEDGDDGVSEEQ… |
| A0A413CZI9 | 91-233 | None |
| A0A1G7CIN3 | 18-181 | None |
| A0A3N4KDY3 | 136-323 | None |
| A0A2R6KH01 | 11-156 | None |
| A0A0C2E5R5 | 109-266 | None |
| A0A1K2FDS9 | 4-124 | None |
| A0A3N4IHU3 | 91-312 | None |
| A0A5C8K652 | 295-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.