DPCstruct | MC4991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 220 ± 30 aa |
| Standard deviation of domain lengths | 30.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5KLT1 | 195-441 | WILYLSVVFLSDGILPGANALALEQRTWEEVLGLSLNFAFVSPVLHLPFSPSVHPYLEAVFNGLLAYAGLFAGFLVEDDDPKKIGKG… |
| A0A6P0YRW5 | 3-168 | APVLNPTTDALFNVAIAWIFMFLPLLLLDQRGRHLPKVALWGAAMFLTNVFLTPYMALRARNPVEPVITSPKKGVLARIFGVVGFAV… |
| A0A7S0J5P6 | 294-520 | None |
| S0F3N9 | 4-203 | None |
| A0A5B8MQA9 | 368-584 | None |
| A0A383WPZ2 | 270-491 | None |
| A0A7J7IBX3 | 15-285 | None |
| A0A2P5XIW5 | 91-316 | None |
| B7FU12 | 85-307 | None |
| A0A7S2ESU0 | 11-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.