DPCstruct | MC49903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 202 ± 32 aa |
| Standard deviation of domain lengths | 31.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 75.45 |
| Assigned Pfam label(s) | PF18684- PF06101- CL0063- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7IKD7 | 16-194 | FPATVQRSTTAKFEWVWSDAGSGAHGDVAVWRPVPEDGWYALGDYAQGDYTKPAALAVTVRQVGLSDRPLLKAPVGFTQVWNDKGSR… |
| A0A345H8L7 | 1-145 | MLKIKISIVNSFELAWWDKGSGGNMDGAFYNPINIPIGFHTIDSYGQSNYDFPSGSILVVKDNVPDVLAHPVDFKLIYKDTGSRASM… |
| A0A7S2JNS4 | 177-377 | None |
| A0A6S7H7F0 | 891-1078 | None |
| A0A849MIX0 | 36-230 | None |
| A0A2D9NGJ6 | 273-461 | None |
| A0A0C9TMA4 | 188-352 | None |
| A0A2N9I4W2 | 2-152 | None |
| A0A6P8CFW6 | 199-404 | None |
| A0A446JYC2 | 789-996 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.