DPCstruct | MC499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 278 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.25 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF01937- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453LFH8 | 1-304 | GKTISDNKELSDYRPEDISLSLLRMISYNIGQISYLNALRYGLKRIFFGGFFIRGHAYTMDTISFAVHFWSKGEAKAMFLRHEGFLG… |
| A0A2D4HK57 | 134-382 | TVDKDFSKEDMAKSLLHMISNDIGQLACLHAKLHNLDKIYFGGFFIRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAFLK… |
| F1KUE8 | 63-305 | None |
| A0A804QE55 | 218-516 | None |
| A0A4U6W9G9 | 215-516 | None |
| A0A2J8K8V7 | 4-239 | None |
| A0A1I7W718 | 20-325 | None |
| A0A7I8VBT9 | 437-702 | None |
| A0A0R3TQ60 | 33-307 | None |
| A0A835JCY6 | 426-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.