DPCstruct | MC49893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 48 ± 1 aa |
| Standard deviation of domain lengths | 0.66 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 61.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5GYZ8 | 8-54 | MVWIYVDTNHYVGHPDHLKVFADPELADEWFKENDPEGVVFGYEVIE |
| A0A7Z0QDY1 | 1-48 | MSVFVYVNTAKQIGDVEHLKIFATEDAAKDWLDENDPEGVAFEYEVLG |
| A0A7Y4GWV7 | 1-48 | None |
| A0A1N6JMP6 | 1-48 | None |
| A0A2A2VAG6 | 1-47 | None |
| A0A023XF48 | 36-84 | None |
| A0A023XKN0 | 24-70 | None |
| A0A7S7TUR5 | 11-58 | None |
| A0A1B9Z0U7 | 50-96 | None |
| A0A0R3LUA1 | 2-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.