DPCstruct | MC4989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 283 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 63.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.20 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | PF10453- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5KIE8 | 1-285 | MPLAEAPPVMYQYNNSYRQPVNNPNFLTNVSQPPLSTSMPVTSQWKCIPCDLVLESKPALERHTASHVTCTECSFQAAPKVVKAHHQ… |
| A0A0L6V319 | 1-265 | MSYSPYAQHFSAHQLNNSTSSHRFRCEQCKQDYYNLIDLSVHLRNHAKCDYENCKFEALPDILDLHREDRHLIFKPGREPKPKSNPK… |
| A0A0L0G156 | 25-319 | None |
| L5MA91 | 123-404 | None |
| L1JT01 | 1-323 | None |
| I1CSU0 | 22-276 | None |
| A0A7I8VWV8 | 1-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.