DPCstruct | MC49888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 251 ± 38 aa |
| Standard deviation of domain lengths | 37.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0149- PF05542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6MEF2 | 26-267 | LLEYVKTVQPEFMELFVKRAPQPVVDAMRQTVTNMIGTLPPQFFSITINTVAENLAQLMYSVMMTGYMFRNAQYRLELQESLEQVAL… |
| R1F135 | 3-214 | AEFAKTAPEAVQLAVKQTVAALLGQMPAEVADGAITATGQSLASLFFSMQMTGYMFRNAEYRRSLSTTLAAAEDEMAEAAALPPVKG… |
| A0A7S0BNB6 | 34-312 | None |
| A0A7S0Y8J1 | 142-455 | None |
| A0A067KY98 | 4-188 | None |
| A0A6D2K8G2 | 171-422 | None |
| A0A498IY38 | 138-367 | None |
| A0A2R6PPF5 | 33-271 | None |
| A0A200QV55 | 44-325 | None |
| A0A1X1BJR7 | 131-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.